DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and ncs1

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_988973.1 Gene:ncs1 / 394570 XenbaseID:XB-GENE-953740 Length:190 Species:Xenopus tropicalis


Alignment Length:188 Identity:134/188 - (71%)
Similarity:157/188 - (83%) Gaps:1/188 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKSSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFA 65
            |||.:||||.:.::.||..|||||||::||:|||:||||:|.|...||.||||||||.|||:|||
 Frog     1 MGKSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFA 65

  Fly    66 SLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQ 130
            :.||.|||||.||.|||.|||:||||||:|.|||||:|||:|||:||||||||.||.:|||||||
 Frog    66 TFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQ 130

  Fly   131 MVGQQPQ-SEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSLGGG 187
            |||...: .|:||||:||||:||..||||.||||||:||:|||||||.|||||||..|
 Frog   131 MVGNTVELPEEENTPEKRVDRIFAMMDKNSDGKLTLQEFQEGSKADPSIVQALSLYDG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 120/169 (71%)
ncs1NP_988973.1 FRQ1 20..179 CDD:227455 117/158 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6019
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5719
Inparanoid 1 1.050 278 1.000 Inparanoid score I2859
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm48047
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R801
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.