DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and hpcal1

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_957458.1 Gene:hpcal1 / 394139 ZFINID:ZDB-GENE-040426-1242 Length:193 Species:Danio rerio


Alignment Length:183 Identity:104/183 - (56%)
Similarity:141/183 - (77%) Gaps:1/183 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKSSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFA 65
            |||::|||:.:.::.|..:|.||:.|:::|::|||||||:|.||.:.|.|||..|||.||.||||
Zfish     1 MGKQNSKLRPEVLNDLRENTEFTDHELQEWYRGFLKDCPSGHLTVEEFKKIYANFFPYGDASKFA 65

  Fly    66 SLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQ 130
            ..|||.||.|:|.:|:|.|||.||||||:|.|::||:|||.:||:|.:|||:|.||..||.|||:
Zfish    66 EHVFRTFDTNSDATIDFREFIIALSVTSRGGLEQKLRWAFSMYDLDGNGYISRAEMLEIVQAIYK 130

  Fly   131 MVGQ-QPQSEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQAL 182
            ||.. ....|||:||:||.||||.|||.::||:|:||||.:|:|:||.||:.|
Zfish   131 MVSSVMKMPEDESTPEKRTDKIFRQMDTDNDGRLSLEEFIKGAKSDPSIVRLL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 95/169 (56%)
hpcal1NP_957458.1 FRQ1 13..179 CDD:227455 95/165 (58%)
EFh <36..89 CDD:298682 32/52 (62%)
EFh 65..126 CDD:238008 36/60 (60%)
EFh 100..174 CDD:238008 43/73 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100764
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.