DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and kcnip3b

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_957076.1 Gene:kcnip3b / 393755 ZFINID:ZDB-GENE-040426-1752 Length:259 Species:Danio rerio


Alignment Length:174 Identity:78/174 - (44%)
Similarity:118/174 - (67%) Gaps:3/174 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFASLVFRVFDENND 77
            :::|...|.||.||::..::||..:||:||:.|:.|..||.|||||||.:.:|..:|..||.:.:
Zfish    82 LEQLQAQTQFTRKELQSLYRGFKNECPSGLVDEETFKSIYSQFFPQGDATTYAHFLFNAFDMDRN 146

  Fly    78 GSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQ--QPQSED 140
            |||.||:|:..|||..:|::.|||:|||.|||::.|||||:|||..|:.:||.|:|:  .|..:|
Zfish   147 GSIRFEDFVIGLSVLLRGSVTEKLRWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRYTSPCVKD 211

  Fly   141 ENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSL 184
            : ...:.|:|.|.:||:|.||.:|||||.|..:.|..|:.::.|
Zfish   212 D-AAFEHVEKFFQKMDRNRDGVVTLEEFIETCQKDENIMSSMQL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 76/166 (46%)
kcnip3bNP_957076.1 FRQ1 82..248 CDD:227455 76/166 (46%)
EF-hand_8 108..155 CDD:290545 23/46 (50%)
EFh 133..195 CDD:238008 32/61 (52%)
EFh 169..240 CDD:238008 36/71 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.