DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and CG3565

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster


Alignment Length:185 Identity:45/185 - (24%)
Similarity:86/185 - (46%) Gaps:24/185 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IDRLTTDTYFTEKE----IRQWHKGFLKDCPNG-LLTEQGFIKIYKQFFPQGDPSKFASLVFRVF 72
            |.||..|:.|:..|    :..:||..|.:.|.. .:|.|....:.:..|...|....|::|:|:.
  Fly    24 IARLAKDSIFSHNELISIVMLYHKFVLVNGPRAKYMTIQQLSALMELLFEIVDRDLIATIVYRIA 88

  Fly    73 --------DENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIY 129
                    |..:|..|..|.|:|..:|....:|..|:::||.:||..:...:..|:       :.
  Fly    89 HTPGSRPPDFFSDKHIHLESFVRLFTVYFTKDLQLKMEFAFSVYDKSDSKQLNGEQ-------VG 146

  Fly   130 QMVGQQPQSEDEN-TPQKRVD---KIFDQMDKNHDGKLTLEEFREGSKADPRIVQ 180
            ..||:..:||||: :.:.|:|   .:|.:.|.:.|..:.::|:.|..:..|.:::
  Fly   147 FFVGKFFESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRRQPMLLE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 45/181 (25%)
CG3565NP_611942.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442288
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.