DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and guca1c

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_919374.1 Gene:guca1c / 373099 ZFINID:ZDB-GENE-030829-1 Length:188 Species:Danio rerio


Alignment Length:186 Identity:64/186 - (34%)
Similarity:102/186 - (54%) Gaps:22/186 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKSSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQG---DPS 62
            ||..:|.|  |.:  |..|.::       |:..|:::.|:||:|   ..::......||   :.|
Zfish     1 MGAHASNL--DEV--LAEDMHY-------WYNKFMRESPSGLIT---LFELKNMLEMQGMTEEAS 51

  Fly    63 KFASLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDA 127
            .:...||..||.:.||.|:|.|:|.|:|:..||.:::||:|.|:|:|.|.:|.|.|:||..|..|
Zfish    52 SYVDQVFFTFDMDGDGYIDFVEYIAAVSLLLKGEINQKLKWYFKLFDQDGNGKIDRDEMETIFKA 116

  Fly   128 IYQMVGQQPQSEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALS 183
            |     |......|..|...|..|::::|.|::|:||||||..|:|..|.|::.|:
Zfish   117 I-----QDITRSYEIPPDDIVSLIYERIDVNNEGELTLEEFITGAKEHPDIMEMLT 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 58/171 (34%)
guca1cNP_919374.1 FRQ1 6..162 CDD:227455 60/174 (34%)
EFh 53..110 CDD:238008 24/56 (43%)
EFh 89..157 CDD:238008 30/72 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.