DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and CG2256

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster


Alignment Length:211 Identity:54/211 - (25%)
Similarity:97/211 - (45%) Gaps:37/211 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKSSKLKQDTIDRLTTDTYFTEKEI----RQWHKGFLKDC---PNGLLTEQGFIKIYKQFFPQ 58
            |.:.|.|:....:|.|...|.||:.|:    |.:.| .:.:|   ...|.:......|.|   |.
  Fly   101 MDELSGKVNPKLLDSLRKKTRFTKDELDALCRIYRK-LVSNCQYAAKTLASSSSSAAIAK---PH 161

  Fly    59 GDPSKFASLVF------------------RVF---DENNDG-SIEFEEFIRALSVTSKGNLDEKL 101
            ........:||                  |:|   |:.::| .:..|.::..||...:|...|:.
  Fly   162 AAVEGIDRIVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERA 226

  Fly   102 QWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQSEDENTPQK-RVDKIFDQMDKNHDGKLTL 165
            .:.||:||::.||:||::||:.:   :...:.:|||.||.:...| .|:.:..:.|.:.|||::|
  Fly   227 AFCFRVYDLNTDGFITKDEMFTL---LRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSL 288

  Fly   166 EEFREGSKADPRIVQA 181
            |:|.....|:|.:::|
  Fly   289 EDFMGTVTAEPLLIEA 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 50/198 (25%)
CG2256NP_572437.2 EFh 228..292 CDD:238008 23/66 (35%)
EF-hand_7 229..292 CDD:290234 23/65 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442287
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
54.840

Return to query results.
Submit another query.