DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and Guca1b

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001101668.1 Gene:Guca1b / 316218 RGDID:1308191 Length:201 Species:Rattus norvegicus


Alignment Length:177 Identity:64/177 - (36%)
Similarity:111/177 - (62%) Gaps:23/177 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFP---QGDPSKFASLVFRVFDENNDGSIEFEEFIR 87
            |:::|:|.|:.:||:|.|    |:..:|:||.   ..:.:::...:||.||:|.|.:|:|.|::.
  Rat    20 ELQEWYKKFVVECPSGTL----FMHEFKRFFKVTGNEEATQYVEGMFRAFDKNGDNTIDFLEYVA 80

  Fly    88 ALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQM---------VGQQPQSEDENT 143
            ||::..:|.|:.||:|.|::||.|.:|.|.|.|:.:||:|||::         :.||.|.   .|
  Rat    81 ALNLVLRGTLEHKLKWTFKIYDKDRNGCIDRLELLDIVEAIYKLKKACRAELDLEQQGQL---LT 142

  Fly   144 PQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSL----GG 186
            |::.||:||..:|:|.||:|:|.||.||::.|..:::.|.:    ||
  Rat   143 PEEVVDRIFLLVDENGDGQLSLTEFIEGARRDKWVMKMLQMDVNPGG 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 61/163 (37%)
Guca1bNP_001101668.1 FRQ1 15..175 CDD:227455 60/161 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.