Sequence 1: | NP_001033853.1 | Gene: | Frq1 / 32797 | FlyBaseID: | FBgn0030897 | Length: | 187 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001265268.1 | Gene: | KCNIP1 / 30820 | HGNCID: | 15521 | Length: | 241 | Species: | Homo sapiens |
Alignment Length: | 202 | Identity: | 77/202 - (38%) |
---|---|---|---|
Similarity: | 119/202 - (58%) | Gaps: | 26/202 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 KQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQG-------------- 59
Fly 60 -----------DPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDND 113
Fly 114 GYITREEMYNIVDAIYQMVGQQPQSE-DENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPR 177
Fly 178 IVQALSL 184 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Frq1 | NP_001033853.1 | FRQ1 | 9..178 | CDD:227455 | 74/194 (38%) |
KCNIP1 | NP_001265268.1 | FRQ1 | 39..230 | CDD:227455 | 74/190 (39%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0044 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000038 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X31 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.810 |