DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and KCNIP2

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_055406.2 Gene:KCNIP2 / 30819 HGNCID:15522 Length:285 Species:Homo sapiens


Alignment Length:178 Identity:76/178 - (42%)
Similarity:123/178 - (69%) Gaps:3/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFASLVFRVFD 73
            :.:.:::|...|.||.||::..::||..:||:|::.|:.|.:||.|||||||.|.:|:.:|..||
Human   104 RPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFD 168

  Fly    74 ENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQ--QP 136
            .|:|||:.||:|:..|||..:|.:|::|.|||.|||::.||.||:|||.:|:.:||.|:|:  .|
Human   169 TNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYP 233

  Fly   137 QSEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSL 184
            ...:| .|::.|:..|.:||:|.||.:|:|||.|..:.|..|::::.|
Human   234 ALREE-APREHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 74/170 (44%)
KCNIP2NP_055406.2 FRQ1 108..274 CDD:227455 74/166 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.