DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and GUCA1B

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_002089.4 Gene:GUCA1B / 2979 HGNCID:4679 Length:200 Species:Homo sapiens


Alignment Length:167 Identity:64/167 - (38%)
Similarity:109/167 - (65%) Gaps:12/167 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGD---PSKFASLVFRVFDENNDGSIEFEEFIR 87
            |:::|:|.|:.:||:|.|    |:..:|:||...|   .|::...:||.||:|.|.:|:|.|::.
Human    20 ELQEWYKKFVMECPSGTL----FMHEFKRFFKVTDDEEASQYVEGMFRAFDKNGDNTIDFLEYVA 80

  Fly    88 ALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQM---VGQQPQSEDEN--TPQKR 147
            ||::..:|.|:.||:|.|::||.|.:|.|.|.|:.|||:.|||:   ..::.|:|...  ||::.
Human    81 ALNLVLRGTLEHKLKWTFKIYDKDGNGCIDRLELLNIVEGIYQLKKACRRELQTEQGQLLTPEEV 145

  Fly   148 VDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSL 184
            ||:||..:|:|.||:|:|.||.||::.|..:::.|.:
Human   146 VDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQM 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 63/159 (40%)
GUCA1BNP_002089.4 FRQ1 20..174 CDD:227455 62/157 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.