DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and Kcnip4

DIOPT Version :10

Sequence 1:NP_573271.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_852030.1 Gene:Kcnip4 / 259243 RGDID:708539 Length:250 Species:Rattus norvegicus


Alignment Length:178 Identity:74/178 - (41%)
Similarity:124/178 - (69%) Gaps:3/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFASLVFRVFD 73
            :.:.::.|...:.||:||::..::||..:||:|::.|:.|.:||.|||||||.:.:|..:|..||
  Rat    69 RPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFD 133

  Fly    74 ENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQ--QP 136
            .:::|::.||:||:.||:..:|.:.|||.|||.|||::.|||||:|||.:|:.|||.|:|:  .|
  Rat   134 TDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYP 198

  Fly   137 QSEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSL 184
            ..: |:.|::.|:..|.:||||.||.:|::||.|..:.|..|::::.|
  Rat   199 VLK-EDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_573271.1 EFh 39..89 CDD:415501 22/49 (45%)
FRQ1 <69..173 CDD:444056 49/105 (47%)
Kcnip4NP_852030.1 KIS. /evidence=ECO:0000250 2..44
EF-hand_8 99..146 CDD:404678 20/46 (43%)
FRQ1 <128..235 CDD:444056 49/107 (46%)
Interaction with KCND2. /evidence=ECO:0000250|UniProtKB:Q8R426 237..250 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.