DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and ncs1

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_592879.1 Gene:ncs1 / 2542523 PomBaseID:SPAC18B11.04 Length:190 Species:Schizosaccharomyces pombe


Alignment Length:188 Identity:117/188 - (62%)
Similarity:143/188 - (76%) Gaps:1/188 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKSSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFA 65
            |||..|||.||.:..|...|.|.:||::||:|||.||||:|.|.:..|.||||||||.||||.||
pombe     1 MGKSQSKLSQDQLQDLVRSTRFDKKELQQWYKGFFKDCPSGHLNKSEFQKIYKQFFPFGDPSAFA 65

  Fly    66 SLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQ 130
            ..||.|||.:.:|.|:|:|||.||||||:|.|::||.|||:|||:||:|.|:.:||..||||||:
pombe    66 EYVFNVFDADKNGYIDFKEFICALSVTSRGELNDKLIWAFQLYDLDNNGLISYDEMLRIVDAIYK 130

  Fly   131 MVGQQPQ-SEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSLGGG 187
            |||...: .|||:||:|||:|||:.||||.||:||||||.||||.||.||.||||..|
pombe   131 MVGSMVKLPEDEDTPEKRVNKIFNMMDKNKDGQLTLEEFCEGSKRDPTIVSALSLYDG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 104/169 (62%)
ncs1NP_592879.1 FRQ1 9..179 CDD:227455 104/169 (62%)
EFh <36..86 CDD:298682 30/49 (61%)
EFh 65..125 CDD:238008 34/59 (58%)
EFh 100..172 CDD:238008 46/71 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5719
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100764
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R801
SonicParanoid 1 1.000 - - X31
TreeFam 1 0.960 - -
109.800

Return to query results.
Submit another query.