DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and Vsnl1

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_036818.2 Gene:Vsnl1 / 24877 RGDID:3966 Length:191 Species:Rattus norvegicus


Alignment Length:185 Identity:99/185 - (53%)
Similarity:135/185 - (72%) Gaps:3/185 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKSSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFA 65
            |||::|||..:.::.|...|.|.|.|::||:||||||||:|.|..:.|.::|.:|||.||.||||
  Rat     1 MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFA 65

  Fly    66 SLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQ 130
            ...||.||:|.||:|:|.|||.|||:||:|:.::||.|.|.:||:|.||.|||.||..|::|||:
  Rat    66 QHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWVFNMYDLDGDGKITRVEMLEIIEAIYK 130

  Fly   131 MVG---QQPQSEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQAL 182
            |||   ....:||..||::||||||.:||||.|.::||:||:|.:|:||.||..|
  Rat   131 MVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 90/171 (53%)
Vsnl1NP_036818.2 FRQ1 15..181 CDD:227455 90/165 (55%)
EFh 65..125 CDD:238008 33/59 (56%)
EFh 100..176 CDD:238008 41/75 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.