DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and NCS1

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_055101.2 Gene:NCS1 / 23413 HGNCID:3953 Length:190 Species:Homo sapiens


Alignment Length:188 Identity:134/188 - (71%)
Similarity:157/188 - (83%) Gaps:1/188 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKSSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFA 65
            |||.:||||.:.::.||..|||||||::||:|||:||||:|.|...||.||||||||.|||:|||
Human     1 MGKSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFA 65

  Fly    66 SLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQ 130
            :.||.|||||.||.|||.|||:||||||:|.|||||:|||:|||:||||||||.||.:|||||||
Human    66 TFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQ 130

  Fly   131 MVGQQPQ-SEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSLGGG 187
            |||...: .|:||||:||||:||..||||.||||||:||:|||||||.|||||||..|
Human   131 MVGNTVELPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 120/169 (71%)
NCS1NP_055101.2 FRQ1 20..179 CDD:227455 117/158 (74%)
Interaction with IL1RAPL1. /evidence=ECO:0000269|PubMed:12783849 174..190 12/15 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6079
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5719
Inparanoid 1 1.050 277 1.000 Inparanoid score I2944
Isobase 1 0.950 - 0 Normalized mean entropy S161
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm40850
orthoMCL 1 0.900 - - OOG6_100764
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R801
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.