DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and ncs-3

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_508201.2 Gene:ncs-3 / 186953 WormBaseID:WBGene00003565 Length:199 Species:Caenorhabditis elegans


Alignment Length:195 Identity:117/195 - (60%)
Similarity:149/195 - (76%) Gaps:11/195 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKSSKL--KQDTIDRLTTD--------TYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQF 55
            |||..||:  |:....:|||:        ||||:||:::|:|.|::|||:|.|..:.|..|||||
 Worm     1 MGKSQSKVQTKKKANKKLTTEEVQTLEQVTYFTKKELKKWYKDFVRDCPSGELKMEEFQGIYKQF 65

  Fly    56 FPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREE 120
            ||.|||||||:.||.|||:|:||.|.|.|||.|||:||:|.|||||.|||.|||||.||:||::|
 Worm    66 FPNGDPSKFAAFVFNVFDDNHDGHISFSEFIAALSITSRGTLDEKLDWAFSLYDVDKDGFITKDE 130

  Fly   121 MYNIVDAIYQMVGQQPQ-SEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSL 184
            |.:||||||.|:|...: .:||:||||||:|||..||:|.||:||.|||:|||||||.|||||::
 Worm   131 MADIVDAIYSMIGNMLELPKDEDTPQKRVEKIFTNMDRNLDGQLTREEFKEGSKADPWIVQALTM 195

  Fly   185  184
             Worm   196  195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 107/177 (60%)
ncs-3NP_508201.2 FRQ1 19..187 CDD:227455 103/167 (62%)
EFh 77..135 CDD:238008 38/57 (67%)
EFh 110..182 CDD:238008 45/71 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28990
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100764
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.690

Return to query results.
Submit another query.