DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and ncs-7

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001360662.1 Gene:ncs-7 / 182694 WormBaseID:WBGene00015867 Length:239 Species:Caenorhabditis elegans


Alignment Length:182 Identity:57/182 - (31%)
Similarity:101/182 - (55%) Gaps:13/182 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFASLVFRVFDENN 76
            :||.|...|.|:::||:|.::.|.:..|.|.:..:.|..||...||.||...:|.|||:..|:|.
 Worm    55 SIDYLIEITNFSKREIQQLYRSFKELWPIGTVDLEQFQLIYASIFPNGDSKGYAELVFKNIDQNR 119

  Fly    77 DGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQSEDE 141
            .|::.|.:||...|..:||.|||:|.|.|.|||.:..|::...|::::|.::|||:      :..
 Worm   120 VGTVTFLDFITNYSKIAKGTLDERLDWIFTLYDTNRCGFLAYNEIFHVVKSMYQMM------DSS 178

  Fly   142 NTP-------QKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSLGG 186
            ..|       ::.|..:|..::..::||::..||.:..::|..|:.::.|.|
 Worm   179 LKPAVLATICRQHVKIVFKNLNIANNGKVSKAEFLQRCRSDSDILASMELFG 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 54/172 (31%)
ncs-7NP_001360662.1 FRQ1 59..222 CDD:227455 52/168 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28990
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.