DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and ncs-1

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_508186.1 Gene:ncs-1 / 180448 WormBaseID:WBGene00003563 Length:191 Species:Caenorhabditis elegans


Alignment Length:188 Identity:134/188 - (71%)
Similarity:157/188 - (83%) Gaps:1/188 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKSSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFA 65
            |||.:||||...|..|...||||||||:||:|||::|||||:|||.||.|||||||||||||.||
 Worm     1 MGKGNSKLKSSQIRDLAEQTYFTEKEIKQWYKGFVRDCPNGMLTEAGFQKIYKQFFPQGDPSDFA 65

  Fly    66 SLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQ 130
            |.||:|||||.||:|||.|||||||:||:|||||||.|||:|||:|.||:|||.||.:|||:||:
 Worm    66 SFVFKVFDENKDGAIEFHEFIRALSITSRGNLDEKLHWAFKLYDLDQDGFITRNEMLSIVDSIYK 130

  Fly   131 MVGQQPQ-SEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSLGGG 187
            |||...| .|:||||:||||:||..||||:|.:||||||:||:||||.||.||||..|
 Worm   131 MVGSSVQLPEEENTPEKRVDRIFRMMDKNNDAQLTLEEFKEGAKADPSIVHALSLYEG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 121/169 (72%)
ncs-1NP_508186.1 FRQ1 11..179 CDD:227455 120/167 (72%)
EFh 67..125 CDD:238008 42/57 (74%)
EFh 100..174 CDD:238008 49/73 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159630
Domainoid 1 1.000 109 1.000 Domainoid score I3990
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5719
Inparanoid 1 1.050 282 1.000 Inparanoid score I1743
Isobase 1 0.950 - 0 Normalized mean entropy S161
OMA 1 1.010 - - QHG28990
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm14324
orthoMCL 1 0.900 - - OOG6_100764
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R801
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1716.750

Return to query results.
Submit another query.