DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and ncs-6

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_494569.1 Gene:ncs-6 / 173700 WormBaseID:WBGene00021116 Length:338 Species:Caenorhabditis elegans


Alignment Length:195 Identity:38/195 - (19%)
Similarity:73/195 - (37%) Gaps:40/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFASLVF-RVFDENN 76
            :|:|...|.|..|.|...::.|.:.|.||.:|:..:..:::..|||.:.|.|...:: .:..:..
 Worm    90 LDQLVQLTGFNRKWIMFMYRNFKQKCSNGRMTDSQWRILFRSIFPQANDSAFIDRLYAAIVKKKQ 154

  Fly    77 DGSIEFEEFIRAL-SVTSKGNLDE----------KLQWAFRLYDVDNDGYITREEMYNIVDAIYQ 130
            ...|.||:.|..| .::..|...|          :.|:||:|.|.:..|.:.....|.....::.
 Worm   155 HPQITFEDLILCLWELSEDGKTSEMGNYHINSSARAQFAFQLMDEEGKGRVDEPGFYKYTRCVFA 219

  Fly   131 MVGQQPQSEDE-------NTPQKRV---------------------DKIFDQMDKNHDGKLTLEE 167
            :........|:       ..|...:                     .|.|.::|.:.||.:|:.:
 Worm   220 LTAVNKPCTDQIIDASTIGLPASSIYRSTSVDDVLKPMSPLIARFSSKRFKELDTDRDGFITVRD 284

  Fly   168  167
             Worm   285  284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 38/195 (19%)
ncs-6NP_494569.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.