Sequence 1: | NP_001033853.1 | Gene: | Frq1 / 32797 | FlyBaseID: | FBgn0030897 | Length: | 187 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_494569.1 | Gene: | ncs-6 / 173700 | WormBaseID: | WBGene00021116 | Length: | 338 | Species: | Caenorhabditis elegans |
Alignment Length: | 195 | Identity: | 38/195 - (19%) |
---|---|---|---|
Similarity: | 73/195 - (37%) | Gaps: | 40/195 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 IDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFASLVF-RVFDENN 76
Fly 77 DGSIEFEEFIRAL-SVTSKGNLDE----------KLQWAFRLYDVDNDGYITREEMYNIVDAIYQ 130
Fly 131 MVGQQPQSEDE-------NTPQKRV---------------------DKIFDQMDKNHDGKLTLEE 167
Fly 168 167 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Frq1 | NP_001033853.1 | FRQ1 | 9..178 | CDD:227455 | 38/195 (19%) |
ncs-6 | NP_494569.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0044 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |