DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and guca1a

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_571945.1 Gene:guca1a / 140430 ZFINID:ZDB-GENE-011128-5 Length:189 Species:Danio rerio


Alignment Length:186 Identity:66/186 - (35%)
Similarity:112/186 - (60%) Gaps:21/186 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKSSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFP-QG-DP-- 61
            ||..:.    .|:|.|..      .|:..|:|.|:.:||:|.||    :..:||||. :| ||  
Zfish     1 MGNSTG----STVDDLQA------VEMHLWYKKFMTECPSGQLT----LHEFKQFFGLRGLDPKA 51

  Fly    62 SKFASLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVD 126
            :.:...:||.||.|.||.|:|.|::.|||:..:|.::.||:|.|:|||||.:|.|.|.|:.||:.
Zfish    52 NAYIEQMFRTFDMNKDGYIDFMEYVAALSLVMRGKMEHKLRWYFKLYDVDGNGCIDRYELLNIIK 116

  Fly   127 AIYQMVGQQPQSEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQAL 182
            ||..:.|.:.|   |::.::..:::|:::|.|.||:|:|:||..|:::|...::.:
Zfish   117 AIRAINGSETQ---ESSAEEFTNRVFERIDINGDGELSLDEFVAGARSDEEFMEVM 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 64/172 (37%)
guca1aNP_571945.1 EFh <27..76 CDD:298682 22/52 (42%)
EFh 54..116 CDD:238008 29/61 (48%)
EF-hand_7 55..115 CDD:290234 28/59 (47%)
EFh 90..160 CDD:238008 30/72 (42%)
EF-hand_7 91..157 CDD:290234 28/68 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.