DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and Guca1b

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_036016150.1 Gene:Guca1b / 107477 MGIID:1194489 Length:230 Species:Mus musculus


Alignment Length:149 Identity:55/149 - (36%)
Similarity:94/149 - (63%) Gaps:19/149 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFP---QGDPSKFASLVFRVFDENNDGSIEFEEFIR 87
            |:::|:|.|:.:||:|.|    |:..:|:||.   ..:.|::...:||.||:|.|.:|:|.|::.
Mouse    20 ELQEWYKKFVVECPSGTL----FMHEFKRFFKVTGNEEASQYVESMFRAFDKNGDNTIDFLEYVA 80

  Fly    88 ALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQM---------VGQQPQSEDENT 143
            ||::..:|:|:.||:|.|::||.|.:|.|.|.|:.:||:|||::         :..|.|.   .|
Mouse    81 ALNLVLRGSLEHKLKWTFKIYDKDRNGCIDRLELLDIVEAIYKLKKACRAELDLEHQGQL---LT 142

  Fly   144 PQKRVDKIFDQMDKNHDGK 162
            |::.||:||..:|:|.|||
Mouse   143 PEEVVDRIFLLVDENGDGK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 55/149 (37%)
Guca1bXP_036016150.1 FRQ1 15..161 CDD:227455 53/147 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.