DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and Gm40853

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_017170764.2 Gene:Gm40853 / 105245389 MGIID:5623738 Length:239 Species:Mus musculus


Alignment Length:124 Identity:62/124 - (50%)
Similarity:89/124 - (71%) Gaps:1/124 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 DPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNI 124
            |.|||...||...|.|:||:|.|..||.|||:||:|.|::||:|||.:.|:|::|||:..||..:
Mouse   106 DTSKFTEHVFHTCDTNSDGTINFRVFIIALSLTSRGKLEQKLKWAFSMSDLDSNGYISFSEMLEL 170

  Fly   125 VDAIYQMV-GQQPQSEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQAL 182
            |.|||:|| ......||::.|:.|.||||.|||.|::||::|::|.:|:|:||.||:.|
Mouse   171 VQAIYKMVSSMMKMPEDKSMPENRTDKIFRQMDTNNEGKMSLDKFNKGAKSDPSIVRLL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 59/118 (50%)
Gm40853XP_017170764.2 KRAB 45..85 CDD:396083
FRQ1 <107..225 CDD:227455 58/117 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.