DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and guca1c

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_002940159.1 Gene:guca1c / 100497028 XenbaseID:XB-GENE-6039675 Length:188 Species:Xenopus tropicalis


Alignment Length:158 Identity:56/158 - (35%)
Similarity:98/158 - (62%) Gaps:5/158 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALS 90
            |:.:|:..|:|:||:|.|:...|.::........:.:::...||..||.|.||.|:|.|||.|::
 Frog    15 ELHKWYGKFMKECPSGQLSLHEFKELLGLQGMNFEANRYIDQVFSTFDMNKDGFIDFLEFIAAIN 79

  Fly    91 VTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQSEDENTPQKRVDKIFDQM 155
            :..:|.:|:||:|.|:|||.|.:|.|.|:|:.:|:.|:..:.|.:..|.:|.|     ..:|:::
 Frog    80 LVLRGKIDQKLKWYFKLYDADGNGSIDRKELLSILTAVRAINGHRGMSPEEFT-----SMVFEKI 139

  Fly   156 DKNHDGKLTLEEFREGSKADPRIVQALS 183
            |.|.||:||||||..|.:.|.::::.:|
 Frog   140 DVNGDGELTLEEFINGIEKDEQLLEIIS 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 55/151 (36%)
guca1cXP_002940159.1 FRQ1 15..160 CDD:227455 54/149 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.