DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and kcnip4

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_002936758.1 Gene:kcnip4 / 100491280 XenbaseID:XB-GENE-5753458 Length:233 Species:Xenopus tropicalis


Alignment Length:178 Identity:76/178 - (42%)
Similarity:120/178 - (67%) Gaps:3/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFASLVFRVFD 73
            :.:.::.|...|.||:||::..::||..:||:|::.|:.|..||.|||||||.|.:|..:|..||
 Frog    52 RPEALELLEAQTKFTKKELQILYRGFKNECPSGIVNEETFKDIYAQFFPQGDASTYAHFLFNAFD 116

  Fly    74 ENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQ--QP 136
            .:::||:.||:|:..||...:|.:.|||.|||.|||::.|||||:|||::|:.:||.|:|:  .|
 Frog   117 TDHNGSVSFEDFVIGLSTLLRGTIQEKLNWAFNLYDINKDGYITKEEMFDIMKSIYDMMGKCTYP 181

  Fly   137 QSEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSL 184
            ...:| ||::.|:..|.:||.|.||.:|:|||.|..:.|..|:.::.|
 Frog   182 LVREE-TPRQHVENFFQKMDINKDGVVTIEEFIESCQKDENIMCSMQL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 74/170 (44%)
kcnip4XP_002936758.1 FRQ1 63..222 CDD:227455 73/159 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.