DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and guca1bl

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_004913416.1 Gene:guca1bl / 100379842 XenbaseID:XB-GENE-5838913 Length:233 Species:Xenopus tropicalis


Alignment Length:189 Identity:62/189 - (32%)
Similarity:112/189 - (59%) Gaps:19/189 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKSSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFF---PQGDPS 62
            ||:..:..| |.||         ..:::..:|.|:.:||:|.|    |:..:||||   ...:.|
 Frog    41 MGQTQAAYK-DEID---------VADLQDMYKKFVTECPSGAL----FLHEFKQFFGVSANNEVS 91

  Fly    63 KFASLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDA 127
            :|...:|:.||.|.|.:|:|.|::.||::|.:|.|:.||:|:|::||.|.:|.:.:.|:..|:.:
 Frog    92 QFMESLFKSFDRNRDNTIDFLEYVAALNLTLRGKLEHKLRWSFKIYDKDGNGCVDKRELKEIIQS 156

  Fly   128 IYQMV--GQQPQSEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSL 184
            ||.:.  .::.|.....:|::..::||..:|:|.||:|:|:||.||:|.|..:::.|.|
 Frog   157 IYSIKRGWRRDQEAQLMSPEEICERIFQIVDENGDGQLSLQEFVEGAKKDTWVLKMLQL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 58/173 (34%)
guca1blXP_004913416.1 FRQ1 56..207 CDD:227455 53/154 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.