DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and AT5G63740

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_201179.1 Gene:AT5G63740 / 836494 AraportID:AT5G63740 Length:226 Species:Arabidopsis thaliana


Alignment Length:242 Identity:45/242 - (18%)
Similarity:63/242 - (26%) Gaps:126/242 - (52%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DSDNDNDFCDNVDSGNVSSGDDGDDDFGMEVDLPSSADRQMDQDDYQYKVLTTDEIVQHQREIID 66
            |.|.|.|..|:.|..:....||.|||   |.|.....|...|.||        |:..::..|..|
plant    84 DEDEDEDDDDDDDDDDDDDADDADDD---EDDDDEDDDEDEDDDD--------DDDDENDEECDD 137

  Fly    67 EANLLLKLPTPTTRILLNHFKWDKEKLLEKYFDDNTDEFFKCAHVINPFNATEAIKQKTSRSQCE 131
            |                    :|..:|:.                 .|:                
plant   138 E--------------------YDSHRLIS-----------------TPY---------------- 149

  Fly   132 ECEICFSQLPPDSMAGLECGHRFCMPCWHEYLSTKIVAEGLGQTISCAAHGCDILVDDVTVANLV 196
                              |.|:||..||.|||.|...:                |.:::||.:  
plant   150 ------------------CTHKFCKTCWREYLETNFYS----------------LEENLTVIS-- 178

  Fly   197 TDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPYAEPRRVH 243
                                      ||..||..:|::...|...||
plant   179 --------------------------CPDQDCGASVRLKTIEKLGVH 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 8/40 (20%)
IBR <286..326 CDD:279784
AT5G63740NP_201179.1 RING_Ubox <150..184 CDD:388418 15/77 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.