DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and Cul7

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_006244637.1 Gene:Cul7 / 680835 RGDID:1587048 Length:1698 Species:Rattus norvegicus


Alignment Length:256 Identity:46/256 - (17%)
Similarity:90/256 - (35%) Gaps:91/256 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 GENWHDPVKCRWLKKWIKKCDDDSETSNWIAANTKECPRCSVTIEKDGGCNHMVCKNQNCKNEFC 319
            |.|.|...:.|||   |.:..||.::|                             ..:||.|..
  Rat    31 GHNGHPEYQIRWL---ILRRGDDGDSS-----------------------------QVDCKAEHI 63

  Fly   320 WVCLGSWEPHGSSWYNCNRYDEDEAKTARDAQEKLRSSLARYLHYYNRYMNHMQSMKFENKLYAS 384
            .:    |......:.||::...::.:..|.:||...:.                         |.
  Rat    64 LL----WMTDDEIYANCHKMLGEDGQVIRPSQESAEAG-------------------------AL 99

  Fly   385 VKQKMEEMQQHNMSWIEVQFLKKAVDILCQC-----RQTLMYT-YVFAYYLKKNNQSMIFEDNQK 443
            .|..:.||:....|.|:     :|:..|.:|     ...|::| :|.:.|......:.:|:| ::
  Rat   100 DKSVLGEMETDVKSLIQ-----RALRQLEECVGAVPPAPLLHTVHVLSAYASIEPLTGVFKD-RR 158

  Fly   444 DLESATEMLS--EY--------LERDITSEN--------LADIKQKVQDKYRYCEKRCSVL 486
            .|:....|||  :|        :.:.::|.:        |:..:|:..:|:...:.||::|
  Rat   159 VLDLVMHMLSSPDYQIRWSAGRMIQALSSHDAGTRTQILLSLSQQEAIEKHLDFDSRCALL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 3/8 (38%)
IBR <286..326 CDD:279784 3/39 (8%)
Cul7XP_006244637.1 Cul7 351..421 CDD:402903
APC10-like 821..951 CDD:382862
COG5647 <1391..1639 CDD:227934
Cullin <1391..1509 CDD:395716
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.