DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and si:ch211-278j3.3

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_696570.3 Gene:si:ch211-278j3.3 / 568165 ZFINID:ZDB-GENE-041014-147 Length:611 Species:Danio rerio


Alignment Length:229 Identity:66/229 - (28%)
Similarity:99/229 - (43%) Gaps:34/229 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 AIKQKTSRSQCE------ECEICFSQLPPDSMAGL-ECGHRFCMPCWHEYLSTKIVAEGLGQTIS 177
            |:...:|.||.:      ||.:|....|......| .|.||.|..|..:||..:|....:|  |:
Zfish    93 AVLSLSSSSQEQLLEHLVECPLCLLSQPRAHFPRLSSCQHRACTDCLRQYLRIEISESRVG--IA 155

  Fly   178 CAAHGCDILVDDVTVANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPY--AEPR 240
            |......:.:.||..  ::.|..:..::::.....|:..:...||||:.||:||| :.|  ||..
Zfish   156 CPQCPEALALPDVRA--ILDDGALLERFEEFQLRRFLAADPDTRWCPAPDCSYAV-IAYGCAECP 217

  Fly   241 RVHC---KCGHVFCFACGENWHDPVKC----RWLKKWIKKCDD-------DSETSNWIAANTKEC 291
            ::.|   .|...||:.|.:.||....|    |...:.....:|       :.|..:  |...|.|
Zfish   218 KLSCGREGCETEFCYHCRQLWHPDQTCDQARRQRARHTSGANDVSTLYVFNEEPGD--AEEIKPC 280

  Fly   292 PRCSVTIEK--DGGCNHMVCKNQNCKNEFCWVCL 323
            |||...|.|  ||.||.|.|  ..|..:|||:|:
Zfish   281 PRCGAYIMKTNDGSCNRMNC--TVCACQFCWLCM 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 20/64 (31%)
IBR <286..326 CDD:279784 18/40 (45%)
si:ch211-278j3.3XP_696570.3 IBR 179..244 CDD:214763 20/65 (31%)
IBR <276..314 CDD:279784 18/39 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.