DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and rnf217

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001076322.1 Gene:rnf217 / 567287 ZFINID:ZDB-GENE-060503-400 Length:543 Species:Danio rerio


Alignment Length:372 Identity:80/372 - (21%)
Similarity:142/372 - (38%) Gaps:88/372 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDSDNDN------------DFCDNVDSGNVSSGDDGDDDFGMEVDLPSSADRQMDQ--------- 44
            :|.:||:            |...|.:.||    .||:......:||.|..|....:         
Zfish   118 LDHENDDERLQCSTINLQQDIESNPELGN----PDGNHHIDYNIDLKSGEDPSQSKEHVYCTVYC 178

  Fly    45 ---DDYQYKVLTTDEIVQHQREIIDEANLLLKLPTPTTRIL----LNHFKWDKEKLLEKYFDDNT 102
               |:|:..|..|..  .|:......::......:|...:|    |.:.:.|..   :.|....|
Zfish   179 IANDNYRIPVQKTTS--NHETSSSSSSSSSSSSSSPDVLVLPSTDLPNLELDNH---DPYPVPYT 238

  Fly   103 DEFFKCAHVINPFNATEAIKQKTSRSQCEECEICF--SQLPPDSMAGLECGHR-FCMPCWHEYLS 164
            ......:.:.:.:||..::      |....|.||.  .|:.|     |.|..: .|..|...|:.
Zfish   239 VSDLMVSGIHSSYNADNSL------SVVLTCRICLDDKQIMP-----LHCCKKAVCEECLKRYII 292

  Fly   165 TKIVAEGLGQT-ISCAAHGCD-ILVDDVTVANLVTDARVRVKYQQLITNSFVECNQL---LRWCP 224
            :::   .:|:. :.|....|. .|.:::.:::|.::...:.||       |:|.:||   .:.||
Zfish   293 SQV---HVGRAHLVCPITECSGFLEENLVISHLTSEELAKYKY-------FLELSQLDSSTKPCP 347

  Fly   225 SVDCTYAVK-------VPYAEPRRVHC-KCGHVFCFACGENWHDPVKCRWLKKWIKKCDDDSETS 281
            ......:::       .......::.| ||..|:||.|...||:.:|||..:|      .|....
Zfish   348 QCSLFTSLRGRSQQSSTKSEHKYKIQCTKCQFVWCFKCHSPWHEGLKCRDYRK------GDKLLR 406

  Fly   282 NWIAA------NTKECPRCSVTIEKDGGCNHMVCKNQNCKNEFCWVC 322
            :|.:.      |.::||||.:.|::..||:||.|  ..|...||:.|
Zfish   407 HWASVIERGQRNAQKCPRCKIHIQRTEGCDHMTC--TQCSTNFCYRC 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 17/70 (24%)
IBR <286..326 CDD:279784 15/43 (35%)
rnf217NP_001076322.1 IBR 328..395 CDD:214763 17/73 (23%)
IBR <417..455 CDD:279784 15/37 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.