DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and rnf19a

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001313624.1 Gene:rnf19a / 557995 ZFINID:ZDB-GENE-030131-9414 Length:913 Species:Danio rerio


Alignment Length:230 Identity:66/230 - (28%)
Similarity:100/230 - (43%) Gaps:31/230 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 FNATEAIKQKTSRSQCEECEICFSQLP----PDSMAGLECGHRFCMPCWHEYLSTKIVAEGLGQT 175
            :.::.......|.|:..||.:|..:..    ||.|.   |.||.|..|..:||..:|....:  .
Zfish   181 YTSSSCSSSSGSTSELLECPLCLLRHTRDRFPDIMT---CHHRSCADCLRQYLRIEISESRV--N 240

  Fly   176 ISCAAHGCDILVDDVTVANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPY--AE 238
            |||..  |....:...:..::.|..:..||::.:...::..:...||||:.||.||| :.:  |.
Zfish   241 ISCPE--CSERFNPHDIRMILNDRVLMEKYEEFMLRRWLVADPDCRWCPAPDCGYAV-IAFGCAS 302

  Fly   239 PRRVHC---KCGHVFCFACGENWHDPVKC----------RWLKKWIKKCDDDSETSNWIAANTKE 290
            ..::.|   .||..||:.|.:.||....|          ..|:.:.......|:.|...|.:.|.
Zfish   303 CPKITCGRDGCGTEFCYHCKQLWHPNQTCDAARQQRAQSLRLRPFRSSSLSYSQESGAAADDIKP 367

  Fly   291 CPRCSVTIEK--DGGCNHMVCKNQNCKNEFCWVCL 323
            ||||:..|.|  ||.||||.|....|  ||||:|:
Zfish   368 CPRCAAYIIKMNDGSCNHMTCAVCGC--EFCWLCM 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 20/64 (31%)
IBR <286..326 CDD:279784 20/40 (50%)
rnf19aNP_001313624.1 IBR 266..331 CDD:214763 20/65 (31%)
IBR <364..402 CDD:279784 20/39 (51%)
AzlC <428..517 CDD:294385
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.