DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and Rnf144a

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001075879.1 Gene:Rnf144a / 500636 RGDID:1561737 Length:292 Species:Rattus norvegicus


Alignment Length:213 Identity:63/213 - (29%)
Similarity:93/213 - (43%) Gaps:35/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 CEICFSQLPPDSMAGL-ECGHRFCMPCWHEYLSTKIVAEGLGQTISCAAHGC----DILVDDVTV 192
            |::|..:.|.:.|..: :|...||..|..:|:.. ::.|||...|||....|    .:..:::  
  Rat    20 CKLCLGEYPAEQMTTIAQCQCIFCTLCLKQYVEL-LIKEGLETAISCPDAACPKQGHLQENEI-- 81

  Fly   193 ANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVK---VPYAEPRRVHCK-CGHVFCFA 253
             ..:..|.:..:|::|.....|..:....|||:..|....:   :....|:.|.|| |...||.|
  Rat    82 -ECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDIGLQTPQLVQCKACDMEFCSA 145

  Fly   254 CGENWHDPVKC------RWLKKWIKKCDDDSETSNWIA-----ANTKECPRCSVTIEKDGGCNHM 307
            |...||....|      .:|         ..|||:...     |..|.||:|.|.||:|.||..|
  Rat   146 CKARWHPGQGCPETMPISFL---------PGETSSAFKVEEGDAPIKRCPKCRVYIERDEGCAQM 201

  Fly   308 VCKNQNCKNEFCWVCLGS 325
            :||  |||:.|||.||.|
  Rat   202 MCK--NCKHAFCWYCLES 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 18/63 (29%)
IBR <286..326 CDD:279784 23/40 (58%)
Rnf144aNP_001075879.1 mRING-HC-C4C4_RBR_RNF144A 19..72 CDD:319691 16/52 (31%)
IBR 91..156 CDD:214763 18/64 (28%)
IBR <179..216 CDD:396187 21/38 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.