DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and rnf144ab

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_005160733.1 Gene:rnf144ab / 437000 ZFINID:ZDB-GENE-040718-486 Length:294 Species:Danio rerio


Alignment Length:206 Identity:63/206 - (30%)
Similarity:96/206 - (46%) Gaps:19/206 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 CEICFSQLPPDSMAGL-ECGHRFCMPCWHEYLSTKIVAEGLGQTISCAAHGC----DILVDDVTV 192
            |::|..:.|.:.|..: :|...||..|..:|:.. ::.|||...|||....|    .:|.:::  
Zfish    20 CKLCLGEFPLEQMTTISQCQCIFCSLCLKQYVEL-LIKEGLETAISCPDSTCPKQGHLLENEI-- 81

  Fly   193 ANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPYAE---PRRVHC-KCGHVFCFA 253
             ..:....|...|::|.....|..:....||||..|....::..||   |:.|.| :|...||.|
Zfish    82 -ECMVAGEVMQHYKRLQFEREVLLDPCRTWCPSSSCQAVCQLNEAEVQLPQPVQCPECSLRFCSA 145

  Fly   254 CGENWHDPVKCRWLKKWIKKCDDDSETSNWIA----ANTKECPRCSVTIEKDGGCNHMVCKNQNC 314
            |..:.|....|:.:.........::.:||..:    |..|.||:|.|.||:|.||..|:||  ||
Zfish   146 CRADCHTGQACQEMLPITTFLPGENGSSNLKSQEDEAPIKRCPKCKVYIERDEGCAQMMCK--NC 208

  Fly   315 KNEFCWVCLGS 325
            |:.|||.||.|
Zfish   209 KHAFCWYCLES 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 19/63 (30%)
IBR <286..326 CDD:279784 23/40 (58%)
rnf144abXP_005160733.1 IBR 93..156 CDD:214763 19/62 (31%)
IBR <179..218 CDD:279784 21/40 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.