DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and rbck1

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001002168.1 Gene:rbck1 / 431715 ZFINID:ZDB-GENE-040704-3 Length:515 Species:Danio rerio


Alignment Length:335 Identity:72/335 - (21%)
Similarity:118/335 - (35%) Gaps:122/335 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DDYQYKVLTTDEI--VQHQREIIDEANLLLKLPTPTTRILLNHFKWDKEKLLEKYFDDNTDEFFK 107
            |:.:.:.|..:|:  :|:::.::.|                     ::...||:  ..|.:|..:
Zfish   231 DESETRRLQQEELASLQYEQSLLQE---------------------EERNFLER--QRNYEELLQ 272

  Fly   108 CAHVINPFNATEAIKQKTSRSQCEECEICFSQLPPDSMAGL-ECGHRFCMPCWHEYLSTKIVAEG 171
                      |:|.....:..|. ||.|||..:.|...|.| ||.|.||..|....:...:.|| 
Zfish   273 ----------TDAHSLVGNTDQL-ECAICFGTIMPGEGAVLRECLHSFCRDCLKGTVVNCLDAE- 325

  Fly   172 LGQTISCA----AHGCDILVDDVTVANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAV 232
                :.|.    |:.|:..:.|..:.:|:|    :.:||:     |:|                :
Zfish   326 ----VCCPYGDNAYACNCKLQDREIKSLLT----QDEYQK-----FLE----------------L 361

  Fly   233 KVPYAEPR---RVHCK---------------------CGHVFCFACGENWHDPVKCRWLKKWIKK 273
            ::..||.|   ..|||                     |....|..| :..|..:.|       |:
Zfish   362 RLNIAESRSENSYHCKTPDCAGWCIFEDDVNEFKCDICNETNCLLC-KAIHKGMNC-------KE 418

  Fly   274 CDDDSET---SNWIAANTKE-------------CPRCSVTIEKDGGCNHMVCKNQNCKNEFCWVC 322
            ..||...   ::..|..|.|             ||:|.|.::|..||:.:.|  ..||.|.|||.
Zfish   419 YQDDLRVRAQNDEAARQTTEMLDQLLKNGEAMNCPKCQVIVQKKDGCDWICC--LMCKTEICWVT 481

  Fly   323 -LGSWEPHGS 331
             ...|.|.|:
Zfish   482 KQARWGPLGA 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 14/83 (17%)
IBR <286..326 CDD:279784 16/53 (30%)
rbck1NP_001002168.1 UBQ 62..136 CDD:320785
RanBP2-type Zn finger 195..214 CDD:275376
RING_Ubox 283..337 CDD:327409 19/59 (32%)
IBR 356..409 CDD:307574 12/74 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.