DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and Rnf144b

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001102351.1 Gene:Rnf144b / 364681 RGDID:1308856 Length:301 Species:Rattus norvegicus


Alignment Length:207 Identity:66/207 - (31%)
Similarity:94/207 - (45%) Gaps:31/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 CEICFSQLPPDSMAGL-ECGHRFCMPCWHEYLSTKIVAEGLGQTIS-----CAAHGCDILVDDVT 191
            |::|..:...|.|..| ||...||.||..:|:...| .||.|..|:     |..||   .:.:..
  Rat    30 CKLCLCEQSLDKMTILQECQCIFCTPCLKQYMVLSI-REGCGSPITCPDMVCLNHG---TLQEAE 90

  Fly   192 VANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPYAEPRR---VHCKCGHV-FCF 252
            :|.||.....:: ||:|.....|..:.|..|||..||.....:...:|.:   |.|...|: ||.
  Rat    91 IACLVPVDEFQL-YQRLKFEREVHMDPLRTWCPVADCQTVCHITAGDPGQPVSVECPSCHLKFCS 154

  Fly   253 ACGENWHDPVKCRWLKKWIKK------CDDDSETSNWIAANTKECPRCSVTIEKDGGCNHMVCKN 311
            .|.:.||:...||..:..:.:      .|.||.        .|:||.|.:.||::.||..|:|| 
  Rat   155 CCKDAWHEESSCRDSQSAMPEHGALFGTDADSP--------IKQCPVCRIYIERNEGCAQMMCK- 210

  Fly   312 QNCKNEFCWVCL 323
             |||:.|||.||
  Rat   211 -NCKHTFCWYCL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 19/63 (30%)
IBR <286..326 CDD:279784 19/38 (50%)
Rnf144bNP_001102351.1 mRING-HC-C4C4_RBR_RNF144B 28..84 CDD:319692 18/54 (33%)
IBR 101..166 CDD:214763 19/65 (29%)
IBR <183..223 CDD:396187 22/49 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.