DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and CG33144

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001188904.1 Gene:CG33144 / 36131 FlyBaseID:FBgn0053144 Length:1102 Species:Drosophila melanogaster


Alignment Length:349 Identity:81/349 - (23%)
Similarity:124/349 - (35%) Gaps:120/349 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 DEIVQHQREIIDEANLLLKLPTPTTRILLNHFKWDKEKLLEKYFDDNTDEFFKCAHVINPFNATE 119
            |.|...:||::..|::...:.||.|                                     .|.
  Fly   745 DGIALKRREMLASADVTPSVGTPAT-------------------------------------PTT 772

  Fly   120 AIKQKTSRSQCEECEICFSQLPP--DSMAGLECGHRFCMPCWHEYLSTKIVAEGLGQ----TISC 178
            |.|..|       |::|...:..  ::||..:||.:||:.|...|:..:| :||..:    ..:|
  Fly   773 AFKPFT-------CKLCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEI-SEGAYEISCPDATC 829

  Fly   179 AAHGCDILVDDVTVANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDC-TYAVKVPYAEPRR- 241
            .|.|...|.:   :|||.|...:: |:.:...|..:|.::...|||...| |.......|:|.: 
  Fly   830 PAQGAISLPE---IANLTTTNLLK-KHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQS 890

  Fly   242 ------------------------------------------VHC-KCGHVFCFACGENWHDPVK 263
                                                      ||| .|...||..|.:.:|..:.
  Fly   891 SVICQMDESPSTSQSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNIS 955

  Fly   264 C-RWLKKWIKKCDD------DSETSNWIAANTKECPRCSVTIEKDGGCNHMVCKNQNCKNEFCWV 321
            | .:.::.|....|      |:|.       .|.||.|:|.||||.||..|:||  .||:.|||.
  Fly   956 CDEFGRRLIADGQDDIGIPFDNEL-------IKCCPMCAVPIEKDEGCAQMMCK--RCKHVFCWY 1011

  Fly   322 CLGSWEPHGSSWYNCNRYDEDEAK 345
            ||.|.:..    :....||:...|
  Fly  1012 CLASLDDD----FLLRHYDKGPCK 1031

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 18/104 (17%)
IBR <286..326 CDD:279784 21/39 (54%)
CG33144NP_001188904.1 IBR 850..956 CDD:214763 18/106 (17%)
IBR <976..1014 CDD:279784 22/46 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.