DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and Rnf19b

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_008762369.2 Gene:Rnf19b / 313806 RGDID:1305470 Length:730 Species:Rattus norvegicus


Alignment Length:217 Identity:64/217 - (29%)
Similarity:94/217 - (43%) Gaps:41/217 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 ECEICFSQLPPDSMAG-LECGHRFCMPCWHEYLSTKIVAEGLGQTISCAAHGCDILVDDVTVANL 195
            ||.:|..:|||:.... |.|.||.|..|...||..:|....:  .|||..  |...::...:..|
  Rat   112 ECPLCLVRLPPERAPRLLSCPHRSCRDCLRHYLRLEISESRV--PISCPE--CSERLNPHDIRLL 172

  Fly   196 VTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPY--AEPRRVHCK---CGHVFCFACG 255
            :.|..:..||::.:...::..:...||||:.||.||| :.|  |...::.|:   |...||:.|.
  Rat   173 LADPPLMHKYEEFMLRRYLASDPDCRWCPAPDCGYAV-IAYGCASCPKLTCEREGCQTEFCYHCK 236

  Fly   256 ENWHDPVKCRWLKKWIKKCDDDSETSNWIAANTKE-----------------CPRCSVTIEK--D 301
            :.||....|...::         :.:..:...||.                 |||||..|.|  |
  Rat   237 QIWHPNQTCDMARQ---------QRAQTLRVRTKHTSGLSYGQESGPDDIKPCPRCSAYIIKMND 292

  Fly   302 GGCNHMVCKNQNCKNEFCWVCL 323
            |.||||.|....|  ||||:|:
  Rat   293 GSCNHMTCAVCGC--EFCWLCM 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 20/64 (31%)
IBR <286..326 CDD:279784 22/57 (39%)
Rnf19bXP_008762369.2 RING_Ubox 113..166 CDD:418438 18/56 (32%)
RING-HC finger (C3HC4-type) 113..160 CDD:319361 17/50 (34%)
IBR 181..245 CDD:214763 20/64 (31%)
IBR <276..314 CDD:396187 20/39 (51%)
AzlC <340..429 CDD:412452
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.