DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and Rnf217

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001139821.1 Gene:Rnf217 / 268291 MGIID:3610311 Length:515 Species:Mus musculus


Alignment Length:212 Identity:57/212 - (26%)
Similarity:88/212 - (41%) Gaps:44/212 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 CEICFSQLPPDSMAGLECGHRFCMPCWHEYLSTKIVAEGLGQT-ISCAAHGCDILVDDVTVA-NL 195
            |.:|....|...:..  |....|..|...|||:::   .|||. |.|....|...:::.||. ||
Mouse   236 CRVCLEDKPIKPLPC--CKKAVCEECLKIYLSSQV---QLGQVEIKCPVTECFEFLEETTVVYNL 295

  Fly   196 VTDARVRVKYQQLITNSFVECNQL---LRWCPSVDC----TYAVKVPYAEPRR------VHC-KC 246
            ..:..::.||       |:|..::   .:.||  .|    |:..|.....|.|      :.| .|
Mouse   296 THEDSIKYKY-------FLELGRIDSSTKPCP--QCKHFTTFKKKGHIPTPSRSESRYKIQCPTC 351

  Fly   247 GHVFCFACGENWHDPVKCRWLKKWIKKCDDDSETSNWIA------ANTKECPRCSVTIEKDGGCN 305
            ..::||.|...||:.|.|:..||      .|....:|.:      .|.::||:|.:.|::..||:
Mouse   352 QLIWCFKCHSPWHEGVNCKEYKK------GDKLLRHWASEIEHGQRNAQKCPKCKIHIQRTEGCD 410

  Fly   306 HMVCKNQNCKNEFCWVC 322
            ||.|  ..|...||:.|
Mouse   411 HMTC--SQCNTNFCYRC 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 19/73 (26%)
IBR <286..326 CDD:279784 14/37 (38%)
Rnf217NP_001139821.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..125
Tankyrase_bdg_C <62..131 CDD:291973
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..189
TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 232..451 57/212 (27%)
IBR 302..369 CDD:214763 19/75 (25%)
IBR <397..429 CDD:279784 12/31 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.