Sequence 1: | NP_001245736.1 | Gene: | ari-1 / 32796 | FlyBaseID: | FBgn0017418 | Length: | 503 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_877434.2 | Gene: | RNF144B / 255488 | HGNCID: | 21578 | Length: | 303 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 65/201 - (32%) |
---|---|---|---|
Similarity: | 93/201 - (46%) | Gaps: | 17/201 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 133 CEICFSQLPPDSMAGL-ECGHRFCMPCWHEYLSTKIVAEGLGQTIS-----CAAHGCDILVDDVT 191
Fly 192 VANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPYAEPRR---VHCKCGHV-FCF 252
Fly 253 ACGENWHDPVKCRWLKKWIKKCDDDSETSNWIAANTKECPRCSVTIEKDGGCNHMVCKNQNCKNE 317
Fly 318 FCWVCL 323 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ari-1 | NP_001245736.1 | IBR | 204..264 | CDD:214763 | 20/63 (32%) |
IBR | <286..326 | CDD:279784 | 21/38 (55%) | ||
RNF144B | NP_877434.2 | TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 | 26..244 | 65/201 (32%) | |
mRING-HC-C4C4_RBR_RNF144B | 28..84 | CDD:319692 | 17/54 (31%) | ||
IBR | 101..166 | CDD:214763 | 20/65 (31%) | ||
IBR | <190..225 | CDD:396187 | 20/36 (56%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1815 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |