DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and RNF144B

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_877434.2 Gene:RNF144B / 255488 HGNCID:21578 Length:303 Species:Homo sapiens


Alignment Length:201 Identity:65/201 - (32%)
Similarity:93/201 - (46%) Gaps:17/201 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 CEICFSQLPPDSMAGL-ECGHRFCMPCWHEYLSTKIVAEGLGQTIS-----CAAHGCDILVDDVT 191
            |::|..:...|.|..| ||...||..|..:|:...| .||.|..|:     |..||   .:.:..
Human    30 CKLCLCEQSLDKMTTLQECQCIFCTACLKQYMQLAI-REGCGSPITCPDMVCLNHG---TLQEAE 90

  Fly   192 VANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPYAEPRR---VHCKCGHV-FCF 252
            :|.||...:.:: ||:|.....|..:....|||..||.....|..::|.:   |.|...|: ||.
Human    91 IACLVPVDQFQL-YQRLKFEREVHLDPYRTWCPVADCQTVCPVASSDPGQPVLVECPSCHLKFCS 154

  Fly   253 ACGENWHDPVKCRWLKKWIKKCDDDSETSNWIAANTKECPRCSVTIEKDGGCNHMVCKNQNCKNE 317
            .|.:.||..|.||..:..:...:..:.......|..|:||.|.|.||::.||..|:||  |||:.
Human   155 CCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAEAPIKQCPVCRVYIERNEGCAQMMCK--NCKHT 217

  Fly   318 FCWVCL 323
            |||.||
Human   218 FCWYCL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 20/63 (32%)
IBR <286..326 CDD:279784 21/38 (55%)
RNF144BNP_877434.2 TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 26..244 65/201 (32%)
mRING-HC-C4C4_RBR_RNF144B 28..84 CDD:319692 17/54 (31%)
IBR 101..166 CDD:214763 20/65 (31%)
IBR <190..225 CDD:396187 20/36 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.