DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and CUL9

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_011512724.1 Gene:CUL9 / 23113 HGNCID:15982 Length:2566 Species:Homo sapiens


Alignment Length:495 Identity:126/495 - (25%)
Similarity:195/495 - (39%) Gaps:90/495 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KVLTTDEIVQHQREIIDEANLLLKLPTPTTRILLNHFKWDKEKLLEKYFDDNTDEFFK---CAHV 111
            :.::..|:....::.:.:....|.|.....:.||.|..|..|:||:.|.:|.......   |.| 
Human  2044 RTMSPQEVEGLMKQTVRQVQETLNLEPDVAQHLLAHSHWGAEQLLQSYSEDPEPLLLAAGLCVH- 2107

  Fly   112 INPFNATEAIKQKTSRSQCEECEICFSQLP-PDSMAGLECGHRFCMPCWHEYLSTKIVAEGLGQT 175
                 ..:|:..:.     :.|.:|.|.|. .|.:..|.|.|..|..||:|||:|:| .:.|...
Human  2108 -----QAQAVPVRP-----DHCPVCVSPLGCDDDLPSLCCMHYCCKSCWNEYLTTRI-EQNLVLN 2161

  Fly   176 ISCAAHGCDILVDDVTVANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPYAEPR 240
            .:|....|........:..:|:...|..||::.:...:||....|.||             ..|:
Human  2162 CTCPIADCPAQPTGAFIRAIVSSPEVISKYEKALLRGYVESCSNLTWC-------------TNPQ 2213

  Fly   241 ---RVHC-----------KCGHVFCFACG-ENWHDPVKCRWLKKWIKKCDD---------DSETS 281
               |:.|           |||...||.|. ...|.|..|..:.:|:   ||         ::::.
Human  2214 GCDRILCRQGLGCGTTCSKCGWASCFNCSFPEAHYPASCGHMSQWV---DDGGYYDGMSVEAQSK 2275

  Fly   282 NWIAANTKECPRCSVTIEKDGGCNHMVCKNQNCKNEFCWVCLGSWEPHGSSWYNCNRYDEDEAKT 346
            :.....:|.||.|...|||:.||.||.|  ..|.:.|||.||.||:|:...:|||:..   .:|.
Human  2276 HLAKLISKRCPSCQAPIEKNEGCLHMTC--AKCNHGFCWRCLKSWKPNHKDYYNCSAM---VSKA 2335

  Fly   347 ARDAQEKLRSSLARYLHYYNRYMNHMQSMKFENKLYASVKQKMEEMQQHNMSWIEVQFLKKAVDI 411
            ||  |||      |:..|..|...|.|:.:|...|...|....|.....:.:     ||..|...
Human  2336 AR--QEK------RFQDYNERCTFHHQAREFAVNLRNRVSAIHEVPPPRSFT-----FLNDACQG 2387

  Fly   412 LCQCRQTLMYTYVFAYYLKKNNQSMIFEDNQKDLESATEMLSEYLE------RDITSE---NLAD 467
            |.|.|:.|.|..|:::|.:......:.|...::||..|..|...||      ||:.|.   ..||
Human  2388 LEQARKVLAYACVYSFYSQDAEYMDVVEQQTENLELHTNALQILLEETLLRCRDLASSLRLLRAD 2452

  Fly   468 IKQKVQDKYRYCEKRCSVLLKHVHEGY-------DKEWWE 500
            ......:..|..::|...:|:|..:.:       ..|.||
Human  2453 CLSTGMELLRRIQERLLAILQHSAQDFRVGLQSPSVEAWE 2492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 18/74 (24%)
IBR <286..326 CDD:279784 18/39 (46%)
CUL9XP_011512724.1 Cul7 366..440 CDD:288381
UBA2_C <593..638 CDD:292812
APC10-like 1167..1297 CDD:295192
CULLIN 1642..1813 CDD:214545
Cullin_Nedd8 1913..1993 CDD:299553
zf-RING_2 2117..2166 CDD:290367 18/49 (37%)
IBR 2190..2252 CDD:214763 18/74 (24%)
IBR <2283..2321 CDD:279784 20/39 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.