DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and C17H11.4

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001359873.1 Gene:C17H11.4 / 182752 WormBaseID:WBGene00015924 Length:94 Species:Caenorhabditis elegans


Alignment Length:86 Identity:52/86 - (60%)
Similarity:65/86 - (75%) Gaps:0/86 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 MSWIEVQFLKKAVDILCQCRQTLMYTYVFAYYLKKNNQSMIFEDNQKDLESATEMLSEYLERDIT 461
            |||||||||::.||.|.:||:||.|.|.|||||:.||.:.:||.||.|||.|||.||..||.|:.
 Worm     1 MSWIEVQFLRQPVDALSECRRTLKYAYAFAYYLEANNLTTLFETNQSDLELATEQLSGMLEGDLE 65

  Fly   462 SENLADIKQKVQDKYRYCEKR 482
            ..:||::|:||||||||.:.|
 Worm    66 DMDLAELKRKVQDKYRYVKLR 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763
IBR <286..326 CDD:279784
C17H11.4NP_001359873.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167537
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 1 1.000 - - FOG0000379
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.