DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and tag-314

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_872234.4 Gene:tag-314 / 179455 WormBaseID:WBGene00008871 Length:404 Species:Caenorhabditis elegans


Alignment Length:267 Identity:53/267 - (19%)
Similarity:90/267 - (33%) Gaps:74/267 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 EKYFDDNTDEFFKCAHVINPFNATEAIKQKTSRSQCEECEICFSQLPPDSMAGL-ECGHRFCMPC 158
            :|..::|..:.|:..:..|.......:|:|........||:|  |:..:....| :|||..|:||
 Worm     3 DKVSENNDIKGFQLTNRENEQPMDLNLKEKKPTFTIVGCELC--QIKDEIRIILRQCGHVVCLPC 65

  Fly   159 WHEYLSTKIVAEGLGQTISCAAHGCDILVDDVTVANLVTDAR--VRVKYQQLITNSFVECNQ--- 218
            ..||:..||:.:| .....|....|:.:|.:..: |.|.|.:  ...:|..::...:::..|   
 Worm    66 VLEYIKNKIIVDG-HPRFKCPLSTCNAVVHENDI-NAVLDEKEPALERYMSIVHRRYLQYKQNKH 128

  Fly   219 -LLRWCPSVDCTYAVKVPYAEPRRVHCKCGHVFCFACGENWHDPVKCRWLKKWIKKCDDDSETSN 282
             ::...||.|                                                       
 Worm   129 SIMAALPSSD------------------------------------------------------- 138

  Fly   283 WIAANTKECPRCSVTIEKDGGCNHMVCKNQNCKNEFCWVC---LGSWEPHGSSWYNCNRYDEDEA 344
                 .|.||.|........|||:::|.|..|...|||:|   :|....|.::...|.....|..
 Worm   139 -----IKRCPLCRSIYMHVVGCNYVICANSACNTAFCWLCEKPMGRPSSHFTTASKCRLGYTDYE 198

  Fly   345 KTARDAQ 351
            :..|..|
 Worm   199 RIFRSIQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 5/63 (8%)
IBR <286..326 CDD:279784 15/42 (36%)
tag-314NP_872234.4 InsA 48..>90 CDD:226202 13/42 (31%)
IBR 119..176 CDD:279784 18/116 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.