DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and RNF19B

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_699172.2 Gene:RNF19B / 127544 HGNCID:26886 Length:732 Species:Homo sapiens


Alignment Length:228 Identity:70/228 - (30%)
Similarity:101/228 - (44%) Gaps:28/228 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 FNATEAIKQKTSRSQCEECEICFSQLPPDSMAG-LECGHRFCMPCWHEYLSTKIVAEGLGQTISC 178
            |:..||.:.....::..||.:|..:|||:.... |.|.||.|..|...||..:|....:  .|||
Human   101 FDDEEAAEGGGPGAEEVECPLCLVRLPPERAPRLLSCPHRSCRDCLRHYLRLEISESRV--PISC 163

  Fly   179 AAHGCDILVDDVTVANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPY--AEPRR 241
            ..  |...::...:..|:.|..:..||::.:...::..:...||||:.||.||| :.|  |...:
Human   164 PE--CSERLNPHDIRLLLADPPLMHKYEEFMLRRYLASDPDCRWCPAPDCGYAV-IAYGCASCPK 225

  Fly   242 VHCK---CGHVFCFACGENWHDPVKC-----------RWLKKWIKKCDDDSETSNWIAANTKECP 292
            :.|:   |...||:.|.:.||....|           |...|.........|:..  |.:.|.||
Human   226 LTCEREGCQTEFCYHCKQIWHPNQTCDMARQQRAQTLRVRTKHTSGLSYGQESGP--ADDIKPCP 288

  Fly   293 RCSVTIEK--DGGCNHMVCKNQNCKNEFCWVCL 323
            |||..|.|  ||.||||.|....|  ||||:|:
Human   289 RCSAYIIKMNDGSCNHMTCAVCGC--EFCWLCM 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 20/64 (31%)
IBR <286..326 CDD:279784 21/40 (53%)
RNF19BNP_699172.2 Required for ubiquitin ligase activity and for protection against staurosporin-induced cell death. /evidence=ECO:0000269|PubMed:27485036 1..318 69/225 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..112 3/10 (30%)
TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 115..337 67/214 (31%)
zf-RING_2 118..166 CDD:290367 18/51 (35%)
IBR 187..251 CDD:214763 20/64 (31%)
IBR <283..321 CDD:279784 21/39 (54%)
AzlC <347..436 CDD:294385
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 618..732
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.