DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and Rnf144a

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_006515007.1 Gene:Rnf144a / 108089 MGIID:1344401 Length:313 Species:Mus musculus


Alignment Length:256 Identity:69/256 - (26%)
Similarity:106/256 - (41%) Gaps:42/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 LEKYFDDNTDEFFKCAHVINPFNATEAIKQK----TSRSQCEECEICFSQLPPDSMAGL-ECGHR 153
            :.:..|.|||.   |...:...:|....:.:    .:......|::|..:.|.:.|..: :|...
Mouse     1 MSRRMDHNTDH---CVISLEDCSAMTTARYRPTWDLALDPLVSCKLCLGEYPAEQMTTIAQCQCI 62

  Fly   154 FCMPCWHEYLSTKIVAEGLGQTISCAAHGC----DILVDDVTVANLVTDARVRVKYQQLITNSFV 214
            ||..|..:|:.. ::.|||...|||....|    .:..:::   ..:..|.:..:|::|.....|
Mouse    63 FCTLCLKQYVEL-LIKEGLETAISCPDAACPKQGHLQENEI---ECMVAAEIMQRYKKLQFEREV 123

  Fly   215 ECNQLLRWCPSVDCTYAVK---VPYAEPRRVHCK-CGHVFCFACGENWHDPVKC------RWLKK 269
            ..:....|||:..|....:   :....|:.|.|| |...||.||...||....|      .:|  
Mouse   124 LFDPCRTWCPASTCQAVCQLQDIGLQTPQLVQCKACDMEFCSACKARWHPGQGCPETMPITFL-- 186

  Fly   270 WIKKCDDDSETSNWIA-----ANTKECPRCSVTIEKDGGCNHMVCKNQNCKNEFCWVCLGS 325
                   ..|||:...     |..|.||:|.|.||:|.||..|:||  |||:.|||.||.|
Mouse   187 -------PGETSSAFKMEEGDAPIKRCPKCRVYIERDEGCAQMMCK--NCKHAFCWYCLES 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 18/63 (29%)
IBR <286..326 CDD:279784 23/40 (58%)
Rnf144aXP_006515007.1 mRING-HC-C4C4_RBR_RNF144A 40..93 CDD:319691 16/53 (30%)
IBR 112..177 CDD:214763 18/64 (28%)
IBR <200..237 CDD:366672 21/38 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.