DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and RBCK1

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_011527439.1 Gene:RBCK1 / 10616 HGNCID:15864 Length:568 Species:Homo sapiens


Alignment Length:281 Identity:63/281 - (22%)
Similarity:91/281 - (32%) Gaps:109/281 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 EAIKQKTSRSQCE-----------------------ECEICFSQLPPDSMAGL-ECGHRFCMPCW 159
            ||::|...|.|.:                       ||.:|:|.|.|.....| ||.|.||..|.
Human   303 EALRQYQQRKQQQQEGNYLQHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLRECLHTFCRECL 367

  Fly   160 HEYLSTKIVAEGLGQTISCA----AHGCDILVDDVTVANLVTDARVRVKYQQLITNSFVECNQLL 220
            ...:.....||     :||.    .:.|...:.:..:..|:|..    .||:.:.          
Human   368 QGTIRNSQEAE-----VSCPFIDNTYSCSGKLLEREIKALLTPE----DYQRFLD---------- 413

  Fly   221 RWCPSVDCTYAVKVPYAEPRRV---HCK---------------------CGHVFCFACGENWHDP 261
                       :.:..||.|..   |||                     |.||.|..| :..|:.
Human   414 -----------LGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLC-KAIHEQ 466

  Fly   262 VKCRWLKKWIKKCDDD--SETSNWIAA-NTKE-------------CPRCSVTIEKDGGCNHMVCK 310
            :.|       |:..:|  ....|.:|| .|.|             ||:|.:.::|..||:.:.| 
Human   467 MNC-------KEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRC- 523

  Fly   311 NQNCKNEFCWVCLG-SWEPHG 330
             ..|..|.|||..| .|.|.|
Human   524 -TVCHTEICWVTKGPRWGPGG 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 14/83 (17%)
IBR <286..326 CDD:279784 16/54 (30%)
RBCK1XP_011527439.1 Hoil1_N 115..189 CDD:176394
ZnF_RBZ 255..275 CDD:197784
RanBP2-type Zn finger 255..274 CDD:275376
zf-RING_UBOX 340..382 CDD:290181 15/46 (33%)
IBR <428..462 CDD:279784 8/34 (24%)
IBR 492..532 CDD:279784 9/41 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.