DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and Sharpin

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_079616.2 Gene:Sharpin / 106025 MGIID:1913331 Length:380 Species:Mus musculus


Alignment Length:147 Identity:31/147 - (21%)
Similarity:48/147 - (32%) Gaps:47/147 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EVDLPSSADRQMDQDDYQYKVLTTDEIVQHQREII---DEANLLLKLPTPTTRILLNHFKWDKEK 92
            |||||.|:..           ...:|:.....:.|   ||     |.......:|..|......:
Mouse   157 EVDLPQSSGN-----------FKKEELATRLSQAIAGGDE-----KAAAQVAAVLAQHHVALNVQ 205

  Fly    93 LLEKYF-----------DDNTD--EFFKCAHV---INPFNATEAIKQKTSRSQCEECEICFSQLP 141
            |:|.:|           :|.|.  .....|||   |:|..:..|::.:.           ||:..
Mouse   206 LMEAWFPPGPIRLQVTVEDATSVLSSSSSAHVSLKIHPHCSIAALQDQV-----------FSEFG 259

  Fly   142 -PDSMAGLECGHRFCMP 157
             |.::.....|...|||
Mouse   260 FPPAVQRWVIGRCLCMP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763
IBR <286..326 CDD:279784
SharpinNP_079616.2 Self-association. /evidence=ECO:0000250|UniProtKB:Q9EQL9 1..177 7/30 (23%)
Sharpin_PH 16..125 CDD:293369
Interaction with SHANK1. /evidence=ECO:0000250|UniProtKB:Q9EQL9 172..305 24/121 (20%)
UBQ 218..297 CDD:294102 15/70 (21%)
zf-RanBP 345..369 CDD:279035
RanBP2-type Zn finger 345..364 CDD:275376
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.