DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and rnf144b

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_031759023.1 Gene:rnf144b / 100124330 XenbaseID:XB-GENE-1010811 Length:337 Species:Xenopus tropicalis


Alignment Length:210 Identity:62/210 - (29%)
Similarity:91/210 - (43%) Gaps:36/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 CEICFSQLPPDSMAGLE-CGHRFCMPCWHEYLSTKIVAEGLGQTISCAAHGC--DILVDDVTVAN 194
            |::|..:.|.|.|..|: |...||..|..:|:...| .||.|..|:|....|  ..::.:..::.
 Frog    64 CKLCLCEHPFDKMTSLQACSCIFCTSCLKQYIQFAI-REGFGSPITCPNTVCTNQGILQEAEISA 127

  Fly   195 LVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPYAE---PRRVHCK-CGHVFCFACG 255
            ||...:::: ||:|.....|..:....|||:|||.....|...:   |..|.|. |...||..|.
 Frog   128 LVPVEQLQL-YQRLKLEREVHMDPCKTWCPTVDCHTVCHVETGDSGLPVPVDCSACLIKFCSVCK 191

  Fly   256 ENWHDPVKCR------------WLKKWIKKCDDDSETSNWIAANTKECPRCSVTIEKDGGCNHMV 308
            ..||....|:            .|.|.:..|             .|:||.|.:.||::.||..|:
 Frog   192 NIWHPGQSCQVNLPIIPPEKGILLTKDVDAC-------------IKQCPVCRIYIERNEGCAQMM 243

  Fly   309 CKNQNCKNEFCWVCL 323
            ||  ||::.|||.||
 Frog   244 CK--NCRHTFCWYCL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 20/63 (32%)
IBR <286..326 CDD:279784 18/38 (47%)
rnf144bXP_031759023.1 mRING-HC-C4C4_RBR_RNF144B 62..118 CDD:319692 18/54 (33%)
IBR 135..197 CDD:396187 20/62 (32%)
IBR <220..258 CDD:396187 19/52 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.