DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-1 and rnf144a

DIOPT Version :9

Sequence 1:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001095278.1 Gene:rnf144a / 100124307 XenbaseID:XB-GENE-962808 Length:292 Species:Xenopus tropicalis


Alignment Length:212 Identity:63/212 - (29%)
Similarity:92/212 - (43%) Gaps:33/212 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 CEICFSQLPPDSMAGL-ECGHRFCMPCWHEYLSTKIVAEGLGQTISCAAHGC----DILVDDVTV 192
            |::|..:...:.|..: :|...||..|..:|:.. ::.|||...|||....|    .:..:::  
 Frog    20 CKLCLGEYTVEQMTTIAQCQCIFCTLCLKQYVEL-LIKEGLETAISCPDASCPKRGHLQENEI-- 81

  Fly   193 ANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVP---YAEPRRVHCK-CGHVFCFA 253
             ..:..|.:..||::|.....:..:....||||..|....|:.   ...|:.|.|. |...||.|
 Frog    82 -ECMVAAEIMQKYKKLQFEKEILLDPCRTWCPSSSCQAVCKLQEKGIQNPQLVQCSACDIEFCSA 145

  Fly   254 CGENWHDPVKC------RWL----KKWIKKCDDDSETSNWIAANTKECPRCSVTIEKDGGCNHMV 308
            |..|||....|      .:|    ..:.|..:||        ...|.||:|.|.||:|.||..|:
 Frog   146 CKANWHPGQGCPENMAITFLPGDSSSFFKSLEDD--------VPIKRCPKCKVYIERDEGCAQMM 202

  Fly   309 CKNQNCKNEFCWVCLGS 325
            ||  |||:.|||.||.|
 Frog   203 CK--NCKHAFCWYCLES 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 20/63 (32%)
IBR <286..326 CDD:279784 22/40 (55%)
rnf144aNP_001095278.1 TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 16..236 63/212 (30%)
RING_Ubox 19..72 CDD:327409 15/52 (29%)
IBR 91..156 CDD:214763 20/64 (31%)
IBR 174..216 CDD:307574 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.