DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wupA and TNNI3

DIOPT Version :9

Sequence 1:NP_728142.1 Gene:wupA / 32794 FlyBaseID:FBgn0283471 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_000354.4 Gene:TNNI3 / 7137 HGNCID:11947 Length:210 Species:Homo sapiens


Alignment Length:195 Identity:67/195 - (34%)
Similarity:103/195 - (52%) Gaps:15/195 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AEEAKKAKQAEIERKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLLLRKKAAEELKKEQERKA 128
            |.|.:.| .|.|.|:.:..|....|....||:|   ::..||.:|:.||.:.|.:||::|.|.:.
Human     9 AREPRPA-PAPIRRRSSNYRAYATEPHAKKKSK---ISASRKLQLKTLLLQIAKQELEREAEERR 69

  Fly   129 AERRRIIEERCGSPRNLSDASEGELQEICEEYYERMYICEGQKWDLEYEVRKKDWEINDLNAQVN 193
            .|:.|.:..|| .|..|:.....|||::|.:.:.|:...:.:::|:|.:|.|...||.||..::.
Human    70 GEKGRALSTRC-QPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTKNITEIADLTQKIF 133

  Fly   194 DLRGKFVKPALKKV--SKYENKFAKLQKKAAE-FNFRNQLKVVKKKEFTLEEEEKEKKP--DWSK 253
            ||||||.:|.|::|  |......|.|..:|.| .:.|..||.|||     |:.|||.:.  ||.|
Human   134 DLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKK-----EDTEKENREVGDWRK 193

  Fly   254  253
            Human   194  193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wupANP_728142.1 Troponin 116..233 CDD:395788 41/119 (34%)
TNNI3NP_000354.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 11/37 (30%)
Troponin-I_N 1..31 CDD:314500 7/22 (32%)
Involved in binding TNC 32..79 16/49 (33%)
Troponin <74..177 CDD:307228 35/103 (34%)
Involved in binding TNC and actin 129..149 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151631
Domainoid 1 1.000 75 1.000 Domainoid score I9066
eggNOG 1 0.900 - - E1_KOG3977
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5120
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566919at2759
OrthoFinder 1 1.000 - - FOG0000525
OrthoInspector 1 1.000 - - otm41636
orthoMCL 1 0.900 - - OOG6_105874
Panther 1 1.100 - - O PTHR13738
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.