DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wupA and TNNI2

DIOPT Version :9

Sequence 1:NP_728142.1 Gene:wupA / 32794 FlyBaseID:FBgn0283471 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001139301.1 Gene:TNNI2 / 7136 HGNCID:11946 Length:182 Species:Homo sapiens


Alignment Length:176 Identity:57/176 - (32%)
Similarity:96/176 - (54%) Gaps:17/176 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 RKKKLRLLLRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASEGELQEICEEYYERMYICE 168
            |::.|:.::.:.||.||:||:.|:.||::..:.|.| .|.:: ..|..|:||:|::.:.::...|
Human    14 RRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHC-PPLHI-PGSMSEVQELCKQLHAKIDAAE 76

  Fly   169 GQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKL---QKKAAEFNFRNQL 230
            .:|:|:|..|:|...|:.|:|.::.||||||.:|.|::|....:...|.   .|.....:.|..|
Human    77 EEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRANL 141

  Fly   231 KVVKKKEFTLEEEEKEKK----PDWSKG---KPGDAKVKEEVEAEA 269
            |.|||     |:.|||:.    .||.|.   |.|....|:..|:|:
Human   142 KQVKK-----EDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFESES 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wupANP_728142.1 Troponin 116..233 CDD:395788 40/119 (34%)
TNNI2NP_001139301.1 Involved in binding TNC 2..48 11/33 (33%)
Troponin 15..145 CDD:366404 41/131 (31%)
Involved in binding TNC and actin 97..117 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151630
Domainoid 1 1.000 75 1.000 Domainoid score I9066
eggNOG 1 0.900 - - E1_KOG3977
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5120
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566919at2759
OrthoFinder 1 1.000 - - FOG0000525
OrthoInspector 1 1.000 - - otm41636
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13738
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2854
SonicParanoid 1 1.000 - - X413
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.