DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wupA and tnni4b.1

DIOPT Version :9

Sequence 1:NP_728142.1 Gene:wupA / 32794 FlyBaseID:FBgn0283471 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_691548.5 Gene:tnni4b.1 / 563091 ZFINID:ZDB-GENE-090312-198 Length:179 Species:Danio rerio


Alignment Length:175 Identity:60/175 - (34%)
Similarity:92/175 - (52%) Gaps:15/175 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 KKGFMTPERKKKLRLLLRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASEGELQEICEEY 160
            ||...|..|:..|:..|.|||...|..|:|:...||...:.||. .|..||..|..||||:|:|.
Zfish     6 KKSKYTATRRLLLKTKLMKKATSMLAAEREQNKRERDDALNERV-PPLKLSGLSAQELQELCKEL 69

  Fly   161 YERMYICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALKKVSK-YENKFAKL--QKKAA 222
            :.::...:..::|||.:|.|.:.||..|..::.|::|...:..||:|.| :::.|..|  .|.::
Zfish    70 HRKIDDVDEARYDLEIKVAKNEIEIQTLTQKIWDMKGSKQRTKLKRVKKSHDSMFGALTESKMSS 134

  Fly   223 EFNFRNQLKVVKKKEFTLEEEEKEKKPDWSK------GKPGDAKV 261
            :.:|:..||.|||     |||:||:..||.|      |..|..|:
Zfish   135 KADFKANLKTVKK-----EEEKKEEVTDWRKNVEAMSGMEGRKKL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wupANP_728142.1 Troponin 116..233 CDD:395788 38/119 (32%)
tnni4b.1XP_691548.5 Troponin 26..142 CDD:279349 36/116 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586139
Domainoid 1 1.000 76 1.000 Domainoid score I8860
eggNOG 1 0.900 - - E1_KOG3977
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5072
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566919at2759
OrthoFinder 1 1.000 - - FOG0000525
OrthoInspector 1 1.000 - - otm24311
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13738
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X413
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.