DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wupA and tnni1a

DIOPT Version :9

Sequence 1:NP_728142.1 Gene:wupA / 32794 FlyBaseID:FBgn0283471 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_686703.4 Gene:tnni1a / 558408 ZFINID:ZDB-GENE-030616-266 Length:188 Species:Danio rerio


Alignment Length:189 Identity:57/189 - (30%)
Similarity:95/189 - (50%) Gaps:23/189 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 MEEASKAKKAKKGFMTPERKKKLRLLLRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASE 150
            |.|..:.:|:|   ::..||..|:.|:..||.|||.:|...|..::::.:.|: ..|......|.
Zfish     1 MPEQGQERKSK---ISASRKLMLKSLMVAKAKEELDQEVLDKEEDKQKYLMEK-APPLQTQSMSF 61

  Fly   151 GELQEICEEYYERMYICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALKKVSKYENKFA 215
            .|||.:|:|.:.::.:.:.:::|:|.:|.....||.|||.:|.||||||.:|.|::|....:...
Zfish    62 SELQGLCQELHAKIDLVDEERYDIEAKVLLNKREIKDLNIKVLDLRGKFKRPPLRRVRVSADAIL 126

  Fly   216 KL---QKKAAEFNFRNQLKVVKKKEFTLEEEEKEKKP----DWSK------GKPGDAKV 261
            :.   .|.....:.|..||.|||      |:.::|:|    ||.|      |..|..|:
Zfish   127 RSLLGSKHKVSMDLRANLKSVKK------EDTEKKRPVEDSDWRKNVEAMSGMEGRKKM 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wupANP_728142.1 Troponin 116..233 CDD:395788 36/119 (30%)
tnni1aXP_686703.4 Troponin 17..148 CDD:307228 40/131 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586142
Domainoid 1 1.000 76 1.000 Domainoid score I8860
eggNOG 1 0.900 - - E1_KOG3977
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5072
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566919at2759
OrthoFinder 1 1.000 - - FOG0000525
OrthoInspector 1 1.000 - - otm24311
orthoMCL 1 0.900 - - OOG6_105874
Panther 1 1.100 - - O PTHR13738
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X413
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.760

Return to query results.
Submit another query.